thu 12 nov · 14:38 · day
food
13 of 32 dishes
- burrito bowlslunch, dinner · 4 servings · 30 min · 21 g protein · keep avocado and salsa out of the boxes until eatinghealthycheapmealprepveggie
- chicken noodle souplunch, dinner · 4 servings · 45 min · 35 g protein · cook the noodles apart if it will be reheatedhigh-proteinhealthymealprepsoup
- chicken, rice and broccoli boxeslunch, dinner · 4 servings · 35 min · 56 g protein · portion into four boxes while warmhigh-proteinhealthymealprep
- chickpea spinach currylunch, dinner · 4 servings · 30 min · 22 g proteinhealthycheapmealprepveggie
- chili sin carnelunch, dinner · 6 servings · 45 min · 20 g protein · freezes wellhealthycheapmealprepveggie
- lentil bologneselunch, dinner · 4 servings · 40 min · 36 g protein · nutritional yeast instead of parmesanhigh-proteinhealthycheapmealprepveggie
- red lentil coconut souplunch, dinner · 4 servings · 30 min · 17 g protein · blend half of it for a thicker souphealthycheapmealprepsoupveggie
- red lentil dallunch, dinner · 4 servings · 35 min · 30 g proteinhigh-proteinhealthycheapmealprepveggie
- roasted vegetable couscouslunch, dinner · 4 servings · 40 min · 23 g protein · good cold, so it works as a lunch boxhealthycheapmealprepveggie
- salmon, potatoes and green beanslunch, dinner · 2 servings · 40 min · 40 g protein · one tray, the potatoes go in firsthigh-proteinhealthy
- shakshukabreakfast, lunch, dinner · 2 servings · 30 min · 28 g proteinhigh-proteinhealthycheapveggie
- tomato souplunch, dinner · 4 servings · 25 min · 5 g protein · good next to a sandwichfasthealthycheapmealprepsoupveggie
- tuna and white bean saladlunch, dinner · 2 servings · 10 min · 45 g protein · no cooking, keeps a day in the fridgefasthigh-proteinhealthycheap