thu 12 nov · 14:30 · day
food
burrito bowls
lunch, dinner · 30 min · 4 servings · about 21 g protein each
healthycheapmealprepveggiekeep avocado and salsa out of the boxes until eating
ingredients
- avocado2 piece
- basmati rice400 g
- bell pepper2 piece
- black beans (400 g can)2 piece
- chili flakes1 tsp
- ground cumin2 tsp
- lime1 piece
- smoked paprika2 tsp
- sweetcorn (300 g can)1 piece
- tomato salsa (jar)1 piece
steps
- cook the rice
- fry the diced bell pepper in oil with paprika, cumin and chili flakes
- add the drained black beans and the sweetcorn, warm through, season with salt
- build bowls, add sliced avocado, lime juice and salsa when eating